PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016483796.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 376aa    MW: 40463.2 Da    PI: 7.4754
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016483796.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.61.4e-13119163347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ I+r + + Rt+ q+ s+ qky
   XP_016483796.1 119 PWTEEEHRLFLLGLQKLGKGDWRGISRNFVTSRTPTQVASHAQKY 163
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.104.9E-4223IPR001878Zinc finger, CCHC-type
PROSITE profilePS501588.515319IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.642112168IPR017930Myb domain
SuperFamilySSF466892.39E-17114169IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-18115167IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-11116162IPR009057Homeodomain-like
SMARTSM007172.6E-11116166IPR001005SANT/Myb domain
CDDcd001671.58E-9119164No hitNo description
PfamPF002495.9E-11119163IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MTRRCSHCNN NGHNSRTCPT TRGGTPTGGV GSSSGGGGGG SGGVRLFGVR LADGSIMKKS  60
ASMGNLSSLH SYHSSSSPNP PGSPSSDVPH LPDGYLSDDP NTHASISANR RLERKKGVPW  120
TEEEHRLFLL GLQKLGKGDW RGISRNFVTS RTPTQVASHA QKYFIRQSNA TRRKRRSSLF  180
DIVADTGTDA SHPLSEEQFM LPPRAIESDK EHLIPPATKA IETDFADTLP SLYLSLKSDF  240
ESMETTPSEP VEETKPNTTT NEIPSVYPAF FPAYIPVPYS FWPSNAVPVP EDRGAEPSHH  300
QILKPIPTVP KEPVNVDELV GMSQLTLADA GSGHIEPSPL SLKLTAEPSR QSAFHASTPV  360
KTAEITKGET APIQAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
GenBankHG9755240.0HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016483796.10.0PREDICTED: transcription factor MYB1R1-like
TrEMBLM1CI930.0M1CI93_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000679940.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA117701922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.15e-77MYB_related family protein